Author : Frederic Sturges Allen
Publisher : Unknown
Page : 0 pages
File Size : 54,8 Mb
Release : 1949
Category : English language
ISBN : LCCN:21000782
Allen S Synonyms And Antonyms
Allen S Synonyms And Antonyms Book in PDF, ePub and Kindle version is available to download in english. Read online anytime anywhere directly from your device. Click on the download button below to get a free pdf file of Allen S Synonyms And Antonyms book. This book definitely worth reading, it is an incredibly well-written.
ALLEN'S SYNONYMS AND ANTONYMS
Author : F. STURGES. ALLEN
Publisher : Unknown
Page : 0 pages
File Size : 53,5 Mb
Release : 2018
Category : Electronic
ISBN : 1033382817
ALLEN'S SYNONYMS AND ANTONYMS by F. STURGES. ALLEN Pdf
Allen's Synonyms and Antonyms (Classic Reprint)
Author : Frederic Sturges Allen
Publisher : Forgotten Books
Page : 504 pages
File Size : 49,7 Mb
Release : 2018-10-18
Category : Foreign Language Study
ISBN : 1396804765
Allen's Synonyms and Antonyms (Classic Reprint) by Frederic Sturges Allen Pdf
Excerpt from Allen's Synonyms and Antonyms Codyi'ur' rozo. By Harper Brother! Copyright. Canada. 1930 Registered at Stationen' Hall. London. England Copyright in Greet Britain and Ireland and in all countrie Mblnx to the Demo Convention All right. Oi publication and translation growing out oi copvfizht in the United State. Oi America. 1920. And in Great Britain. Rm and under treatie vith the United State. Damaiwandotherwieemrem-ervedhyflarpertnrothere. About the Publisher Forgotten Books publishes hundreds of thousands of rare and classic books. Find more at www.forgottenbooks.com This book is a reproduction of an important historical work. Forgotten Books uses state-of-the-art technology to digitally reconstruct the work, preserving the original format whilst repairing imperfections present in the aged copy. In rare cases, an imperfection in the original, such as a blemish or missing page, may be replicated in our edition. We do, however, repair the vast majority of imperfections successfully; any imperfections that remain are intentionally left to preserve the state of such historical works.
Allen's Synonyms and Antonyms
Author : F. Sturges Allen
Publisher : Palala Press
Page : 508 pages
File Size : 44,8 Mb
Release : 2016-05-07
Category : Electronic
ISBN : 1355929601
Allen's Synonyms and Antonyms by F. Sturges Allen Pdf
This work has been selected by scholars as being culturally important, and is part of the knowledge base of civilization as we know it. This work was reproduced from the original artifact, and remains as true to the original work as possible. Therefore, you will see the original copyright references, library stamps (as most of these works have been housed in our most important libraries around the world), and other notations in the work.This work is in the public domain in the United States of America, and possibly other nations. Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work.As a reproduction of a historical artifact, this work may contain missing or blurred pages, poor pictures, errant marks, etc. Scholars believe, and we concur, that this work is important enough to be preserved, reproduced, and made generally available to the public. We appreciate your support of the preservation process, and thank you for being an important part of keeping this knowledge alive and relevant.
Allen's Synonymes and Antonyms
Author : Ab F Sturges Allen
Publisher : Legare Street Press
Page : 0 pages
File Size : 50,6 Mb
Release : 2023-07-18
Category : Electronic
ISBN : 1020394579
Allen's Synonymes and Antonyms by Ab F Sturges Allen Pdf
A comprehensive guide to the English language, including synonyms and antonyms for a wide range of words. Includes examples of usage and explanations of subtle differences in meaning. This work has been selected by scholars as being culturally important, and is part of the knowledge base of civilization as we know it. This work is in the "public domain in the United States of America, and possibly other nations. Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work. Scholars believe, and we concur, that this work is important enough to be preserved, reproduced, and made generally available to the public. We appreciate your support of the preservation process, and thank you for being an important part of keeping this knowledge alive and relevant.
ALLEN'S SYNONYMES AND ANTONYMS
Author : F. STURGES ALLEN, A.B., LL.B.
Publisher : Unknown
Page : 556 pages
File Size : 50,9 Mb
Release : 1921
Category : Electronic
ISBN : 8210379456XXX
ALLEN'S SYNONYMES AND ANTONYMS by F. STURGES ALLEN, A.B., LL.B. Pdf
Allen's Synonyms and Antonyms
Author : Frederic Sturges Allen
Publisher : Barnes & Noble
Page : 452 pages
File Size : 41,6 Mb
Release : 1949
Category : Reference
ISBN : 0064633284
Allen's Synonyms and Antonyms by Frederic Sturges Allen Pdf
A Concise Bibliography for Students of English
Author : Arthur Garfield Kennedy
Publisher : Stanford University Press
Page : 156 pages
File Size : 49,5 Mb
Release : 1957
Category : American literature
ISBN : 8210379456XXX
A Concise Bibliography for Students of English by Arthur Garfield Kennedy Pdf
The Bookman
Author : Anonim
Publisher : Unknown
Page : 706 pages
File Size : 40,8 Mb
Release : 1921
Category : Popular culture
ISBN : UOM:39015030062916
The Bookman by Anonim Pdf
A Concise Bibliography for Students of English
Author : Arthur G. Kennedy
Publisher : Stanford University Press
Page : 176 pages
File Size : 45,5 Mb
Release : 1948
Category : Electronic
ISBN : 8210379456XXX
A Concise Bibliography for Students of English by Arthur G. Kennedy Pdf
Princeton Alumni Weekly
Author : Anonim
Publisher : princeton alumni weekly
Page : 862 pages
File Size : 46,6 Mb
Release : 1938
Category : Electronic
ISBN : PRNC:32101081976811
Princeton Alumni Weekly by Anonim Pdf
A complete dictionary of synonyms and antonyms or synonyms and words of opposite meaning
Author : S. Fallows
Publisher : Рипол Классик
Page : 511 pages
File Size : 43,8 Mb
Release : 2024-06-10
Category : History
ISBN : 9781176559523
A complete dictionary of synonyms and antonyms or synonyms and words of opposite meaning by S. Fallows Pdf
Mental Floss: Curious Compendium of Wonderful Words
Author : Erin McCarthy,Mental Floss
Publisher : Weldon Owen International
Page : 210 pages
File Size : 43,6 Mb
Release : 2023-06-06
Category : Reference
ISBN : 9798886740202
Mental Floss: Curious Compendium of Wonderful Words by Erin McCarthy,Mental Floss Pdf
Ever wonder if there is a synonym for the word synonym? Or why people really hate the word “moist?” Maybe you want to know why we tell a person to take something “with a grain of salt,” or why McDonalds went to war with a dictionary. From obscure words to the best literary insults ever written, this linguistic miscellany is sure to spice up your vocabulary, make you a whizz at word games, and prepare you for plenty of wordy repartee for your next soiree, with some of the most bizarre terms you never knew you needed. A CACOPHONY OF WORDS: Learn the meaning and surprising history of hundreds of words and phrases LOTS OF LISTS: Discover curated collections of literary insults, old-timey words, popular slang, and much more WORD GAME WIZ: Includes tips for mastering popular word games from Scrabble to Wordle WIT FOR WRITERS: Writers looking for just the right word will be inspired by hundreds of unusual and obscure words REFERENCE FOR READERS: Fans of every genre, from Norse Myths to Victorian Romance will find histories, origins, and backstories of the words that make up their favorites reads COMPLETE YOUR COLLECTION: Mental Floss: The Curious Reader, Mental Floss: The Curious Movie Buff, and Mental Floss: The Curious Viewer are also available.
Bro-Dart's Catalog of Books and Book Processing for School Libraries...
Author : Bro-Dart Industries
Publisher : Unknown
Page : 832 pages
File Size : 51,8 Mb
Release : 1967
Category : Children's literature
ISBN : UCAL:B3921496
Bro-Dart's Catalog of Books and Book Processing for School Libraries... by Bro-Dart Industries Pdf
Barron's Dictionary & Thesaurus
Author : Robert Allen
Publisher : Barrons Educational Series
Page : 792 pages
File Size : 49,6 Mb
Release : 2007-04-01
Category : Reference
ISBN : 0764136062
Barron's Dictionary & Thesaurus by Robert Allen Pdf
Here’s an especially handy two-in-one reference volume for middle school and high school students. The top half of every page serves as a standard dictionary, while the bottom half is a thesaurus that presents selected words from the dictionary section and gives a list of synonyms for each. This dictionary-thesaurus combination offers definitions of more than 40,000 words and phrases, augmented with over 100,000 synonyms. Headwords in both sections are printed in color. Each dictionary headword is designated by its part-of-speech and comes with one or more definitions. Every thesaurus headword—in addition to its list of synonyms—comes with an example sentence that uses the word in context. Corresponding dictionary and thesaurus entries are always cited on the same page for fast, easy reference.